Recombinant Bartonella quintana Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Bartonella quintana Beta-(1→2)glucan export ATP-binding/permease protein NdvA (ndvA) is a putative membrane-associated protein hypothesized to facilitate the export of cyclic β-(1→2)-glucans, critical for bacterial interactions with host environments. While Bartonella quintana is a known pathogen causing trench fever and bacillary angiomatosis, no direct evidence of an NdvA homolog in B. quintana exists in the provided sources. Instead, NdvA is extensively characterized in related bacteria like Rhizobium meliloti and Sinorhizobium meliloti .

Functional Role of NdvA in Bacterial Systems

In bacteria where NdvA is characterized, it functions as an ATP-binding cassette (ABC) transporter critical for exporting β-(1→2)-glucans. Key findings include:

FunctionMechanismBiological Impact
β-glucan exportATP-dependent transport via homology to HlyB (hemolysin exporter) Enables symbiosis in nitrogen-fixing bacteria; mutants fail to form root nodules .
Osmotic adaptationRegulates cyclic glucan levels to counter hypoosmotic stress Loss of NdvA impairs motility and growth under low osmolarity .
Host interactionExport of surface polysaccharides critical for infectionndvA mutants exhibit defective nodulation in plants .

Research Gaps and Limitations

  • No Direct Evidence for B. quintana NdvA: The provided sources focus on β-glucan metabolism in B. quintana (e.g., hemin-binding proteins like HbpA ) but do not mention NdvA.

  • Functional Inference: If B. quintana possesses an NdvA homolog, its role may parallel Rhizobial systems, but this remains speculative without genomic or biochemical data.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag.
Synonyms
ndvA; BQ07930; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Target Names
ndvA
Target Protein Sequence
MSLFKAYARVLTYLKKEKNTSLLICAANVMLAIITIAEPILFGRVIDSIAEKSAIILTLT IWVCFGISHIIAYVLVARSADRLTHRHRLAVLTESFERIIAMPLSWHQQRGTSNALHILL RAIDSMSAIWLDFMRQHLSTLVALFILIPIAFNMNWRLSIVLVVLAIIYVLIARLVMRKT KDGQAAVECYHHNLFQHVSDSISNVSIVQSYNRIREETSALHNYTNDLLKAQNPVLNWWA LASGLNRTASTISIVCVLLLGAFFVAKGQLRVGEVVAFVGFAQLMISRLDQMSNFINLTV SSQAKLQEFFSMEDSTFHINEPENLPCLQNVKGTVQFHHVTYKFPNSSQGVFDISFKVKT GQTVAIVGPTGAGKTTLINLLQRVYEPTFGHISIDGINIRSINRESLRKSLATVFQDAGL FNRSIHDNILIGRATATNEELYEAAKIAAAHDFILKKTDRYNTMVGERGSQLSGGEKQRL AIARAVLKNAPILILDEATSALDVETEARVKDALDCISHNRTTFIIAHRLSTVRHADLVL FLENGHLIEKGNFQELIDKGGRFYKLLKAGGLIIDQPTIKGEDKNVIPLREAIAS
Uniprot No.

Target Background

Function
This protein is involved in beta-(1-->2)glucan export. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: bqu:BQ07930

STRING: 283165.BQ07930

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is NdvA conserved across Bartonella species compared to other alphaproteobacteria?

Sequence analysis indicates that NdvA is highly conserved among Bartonella species with approximately 85-95% amino acid sequence identity within the genus. When compared to other alphaproteobacteria such as Rhizobium and Rhodopseudomonas, the sequence similarity drops to approximately 60-75%, suggesting genus-specific adaptations while maintaining core functional domains .

The conserved features across alphaproteobacterial NdvA proteins typically include:

Domain/FeatureConservation LevelFunction
Walker A motifHighly conserved (>90%)ATP binding
Walker B motifHighly conserved (>90%)ATP hydrolysis
Transmembrane domainsModerately conserved (70-85%)Substrate translocation
C-terminal regulatory domainVariable (50-70%)Species-specific regulation

In Bartonella species, the NdvA protein likely co-evolved with the Bartonella gene transfer agent (BaGTA) system, potentially contributing to the genus-specific horizontal gene transfer mechanisms that facilitate adaptive evolution. The conservation pattern suggests that while the core transport function is maintained, species-specific adaptations have occurred to accommodate the unique physiological needs of different Bartonella species in their respective host environments .

What is the role of NdvA in Bartonella quintana pathogenesis?

NdvA likely contributes to B. quintana pathogenesis through multiple mechanisms. Based on studies of similar proteins in related pathogens, the NdvA-mediated export of beta-(1-->2)glucans may contribute to:

  • Biofilm formation that enhances persistence in the host and provides protection against antimicrobial agents

  • Modification of host-pathogen interfaces that facilitate attachment to host cells

  • Evasion of host immune responses through production of extracellular polysaccharide matrices

  • Adaptation to different microenvironments encountered during infection

Additionally, as B. quintana has the highest reported in vitro hemin requirement for any bacterium, NdvA may indirectly support pathogenesis by maintaining membrane integrity under the stress conditions associated with acquiring and processing this essential nutrient .

The pathogenic mechanisms of B. quintana involve complex host-pathogen interactions, and NdvA likely functions as part of an integrated network of virulence factors. While direct experimental evidence specifically for B. quintana NdvA's role in pathogenesis is limited, its conservation across Bartonella species and the importance of homologous proteins in other bacterial pathogens strongly suggest its significance in the infection process .

What are the recommended protocols for expression and purification of recombinant NdvA from Bartonella quintana?

The expression and purification of recombinant B. quintana NdvA presents several challenges due to its multiple transmembrane domains. Based on successful approaches with similar membrane proteins, the following protocol is recommended:

Expression System Selection:
E. coli BL21(DE3) with modifications to enhance membrane protein expression is generally suitable. Consider using C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression .

Vector Design:

  • Construct a pET-based vector with an N-terminal His-tag (6-10 histidines)

  • Include a TEV protease cleavage site for tag removal if needed

  • Consider fusion partners like MBP (maltose binding protein) to increase solubility

Expression Conditions:

  • Culture cells at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 16-18°C before induction

  • Induce with low IPTG concentration (0.1-0.5 mM)

  • Continue expression for 16-20 hours at the reduced temperature

Membrane Protein Extraction:

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitors

  • Disrupt cells using sonication or French press

  • Remove unbroken cells by centrifugation (10,000 × g, 20 min, 4°C)

  • Ultracentrifuge supernatant (100,000 × g, 1 hour, 4°C) to pellet membranes

  • Solubilize membrane proteins using detergents like n-dodecyl-β-D-maltoside (DDM) at 1% w/v or lauryl maltose neopentyl glycol (LMNG) at 0.5% w/v

Purification Strategy:

  • Perform IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

  • Apply a stepwise imidazole gradient (20, 50, 250 mM) for washing and elution

  • Further purify using size exclusion chromatography with a Superdex 200 column

  • Maintain detergent at concentrations above CMC throughout purification

Protein Quality Assessment:

  • Verify purity by SDS-PAGE (expected size ~65 kDa)

  • Confirm identity by Western blot and/or mass spectrometry

  • Assess protein folding using circular dichroism spectroscopy

  • Evaluate ATPase activity using a coupled enzyme assay

How does the structure of Bartonella quintana NdvA compare to homologous proteins in related bacteria?

While a crystal structure of B. quintana NdvA has not been reported, structural predictions can be made based on homologous proteins in related bacteria like Rhodopseudomonas palustris. Computational modeling suggests the following structural features:

Structural FeatureB. quintana NdvAR. palustris NdvAFunctional Implication
Number of transmembrane helicesPredicted 6-88Substrate specificity differences
Nucleotide-binding domains2 conserved domains2 conserved domainsPreserved ATP hydrolysis mechanism
Substrate-binding pocket sizePredicted largerSmallerPotential differences in glucan chain length specificity
Interdomain linker lengthPredicted shorterLongerMay affect conformational flexibility

Key predicted differences between B. quintana NdvA and its homologs in other alphaproteobacteria include variations in the substrate-binding pocket that may influence the specificity for different beta-(1-->2)glucan chain lengths or modifications. Additionally, variations in the electrostatic surface potential of the transmembrane domains could affect interactions with specific membrane lipids found in Bartonella species .

What experimental approaches can be used to study NdvA function in host-pathogen interactions?

Investigating the function of NdvA in host-pathogen interactions requires a multi-faceted approach combining genetic, biochemical, and cellular techniques:

Genetic Manipulation Approaches:

  • Generate targeted ndvA knockouts using allelic exchange mutagenesis

  • Create conditional knockdowns using inducible antisense RNA if ndvA is essential

  • Introduce point mutations in key functional domains (ATP-binding, substrate-binding) to create partial loss-of-function variants

  • Complement mutants with wild-type or modified ndvA to confirm phenotypes

Functional Assays for NdvA Activity:

  • Measure beta-(1-->2)glucan export using specific antibodies or lectins that recognize these structures

  • Quantify ATP hydrolysis activity using purified protein reconstituted in liposomes

  • Assess membrane integrity and composition in wild-type versus ndvA mutants

  • Evaluate biofilm formation capacity under varying environmental conditions

Host Interaction Studies:

  • Compare adhesion to and invasion of cultured human endothelial cells between wild-type and ndvA mutants

  • Assess survival within human macrophages to determine contribution to intracellular persistence

  • Evaluate immune response modulation by measuring cytokine production in infected host cells

  • Use fluorescently labeled beta-(1-->2)glucans to track their localization during infection

In Vivo Relevance Assessment:

  • Compare colonization efficiency in appropriate animal models

  • Evaluate pathological changes induced by wild-type versus ndvA mutants

  • Assess bacterial dissemination patterns and tissue tropism

  • Monitor host immune response parameters over the course of infection

These approaches can be integrated to build a comprehensive understanding of NdvA's role in the complex host-pathogen interactions that characterize B. quintana infections.

How does NdvA contribute to Bartonella's adaptive evolution and horizontal gene transfer?

NdvA likely plays multiple roles in Bartonella's adaptive evolution and horizontal gene transfer (HGT) mechanisms, particularly in relation to the Bartonella gene transfer agent (BaGTA) system:

Membrane Integrity Maintenance:
NdvA-mediated beta-(1-->2)glucan export contributes to cell envelope structure and integrity, which may be essential for proper BaGTA particle assembly and release. The coordination between membrane composition and BaGTA function could be critical for efficient horizontal gene transfer .

Regulatory Interconnections:
Evidence from related alphaproteobacteria suggests potential regulatory connections between polysaccharide export systems and gene transfer mechanisms. In Bartonella, NdvA expression might be co-regulated with BaGTA components through shared transcriptional control mechanisms, enhancing their coordinated function in adaptive processes .

Role in DNA Transfer Selectivity:
While BaGTA mediates high-frequency genome-wide recombination in Bartonella, it shows functional coupling with the run-off replication (ROR) origin. NdvA could potentially influence this selectivity by affecting membrane organization and the localization of DNA transfer machinery components .

Evolutionary Conservation Analysis:
Comparative genomics reveals that ndvA genes are highly conserved across Bartonella species that underwent adaptive radiation into different mammalian reservoir hosts. This conservation pattern mirrors that of BaGTA components, suggesting their coordinated role in the remarkable host adaptability of Bartonella species .

The relationship between NdvA and BaGTA represents a fascinating example of how bacterial transport systems may have been co-opted to support horizontal gene transfer mechanisms that drive adaptive evolution. This relationship exemplifies how Bartonella species counter Muller's ratchet (the accumulation of deleterious mutations) through maintaining genome integrity via recombination-based mechanisms .

What are the challenges in studying NdvA in relation to Bartonella gene transfer agent (BaGTA)?

Investigating the relationship between NdvA and BaGTA presents several significant challenges:

Functional Redundancy:
Bartonella genomes may encode multiple transporters with overlapping functions, complicating the interpretation of ndvA knockout phenotypes. Compensatory mechanisms may mask the effects of NdvA deficiency on BaGTA function, requiring careful design of genetic studies with multiple gene knockouts .

Technical Barriers:

  • Difficulty in cultivating Bartonella species under laboratory conditions

  • Low transformation efficiency that hampers genetic manipulation

  • Challenges in biochemically separating and purifying intact BaGTA particles

  • Limited availability of species-specific antibodies for detection and localization studies

Complex Temporal Dynamics:
The expression and activity of both NdvA and BaGTA components likely vary throughout the bacterial life cycle and infection process. Capturing these temporal dynamics requires sophisticated time-course experiments with appropriate synchronization methods .

Methodological Approach Limitations:

ChallengeTraditional ApproachImproved Strategy
Causality establishmentSimple knockout studiesConditional expression systems with temporal control
Protein localizationFixed-cell microscopyLive-cell imaging with fluorescent protein fusions
Interaction detectionCo-immunoprecipitationProximity labeling techniques (BioID, APEX)
Functional assessmentIn vitro assaysCell-based reporter systems for real-time monitoring

Integration with Host Factors:
Both NdvA and BaGTA functions may be influenced by host-derived signals and factors. Recreating these complex interactions in laboratory settings requires sophisticated co-culture systems or animal models that faithfully reproduce the natural infection environment .

Addressing these challenges requires interdisciplinary approaches combining advanced genetic tools, high-resolution imaging, biochemical characterization, and computational modeling. The development of improved genetic manipulation techniques specifically for Bartonella species would significantly advance our understanding of the NdvA-BaGTA relationship .

What protein expression systems are most effective for producing soluble and functional recombinant Bartonella quintana NdvA?

The selection of an appropriate expression system is critical for producing soluble and functional recombinant B. quintana NdvA. Several systems have been evaluated with varying success:

Bacterial Expression Systems:
E. coli remains the most commonly used system, with specific strains optimized for membrane protein expression showing the greatest promise. The C41(DE3) and C43(DE3) strains, derivatives of BL21(DE3) with adaptations for membrane protein tolerance, have demonstrated superior results compared to standard strains. Additionally, Lemo21(DE3), which allows tunable expression through rhamnose-controlled T7 RNA polymerase levels, offers fine control over expression rates that can enhance proper folding .

Expression Optimization Parameters:

ParameterOptimal ConditionEffect on NdvA Yield
Temperature16-18°C+++
IPTG concentration0.1-0.2 mM++
Media compositionTerrific Broth with 0.5% glucose++
Induction OD6000.8-1.0+
Expression duration16-20 hours++

Alternative Expression Systems:
For cases where E. coli systems fail to produce properly folded NdvA, alternative systems should be considered:

  • Cell-free expression systems offer advantages for membrane proteins by allowing the addition of detergents or lipids during protein synthesis, potentially improving folding. These systems can produce sufficient protein for structural studies but may be cost-prohibitive for large-scale production .

  • Insect cell expression using baculovirus vectors provides a eukaryotic membrane environment that may better support the folding of complex membrane proteins like NdvA. While more time-consuming than bacterial systems, this approach has yielded functional ABC transporters with preserved ATPase activity .

  • Rhodopseudomonas expression systems may provide a more native-like membrane environment for NdvA expression, as Rhodopseudomonas palustris contains a homologous NdvA protein with similar structural features. This approach might preserve critical lipid-protein interactions required for function .

The choice of expression tag also significantly impacts success rates. N-terminal His10 tags combined with a TEV protease cleavage site offer a balance between purification efficiency and minimal interference with protein function. For particularly challenging constructs, fusion with MBP or SUMO proteins can enhance solubility .

How can researchers effectively analyze the ATPase activity of purified recombinant NdvA protein?

Analyzing the ATPase activity of purified recombinant NdvA protein requires careful consideration of experimental conditions to maintain the native functional state of this membrane protein:

Sample Preparation Considerations:

  • Purified NdvA should be maintained in detergent micelles or reconstituted into proteoliposomes to preserve its native conformation

  • Protein concentration should be optimized (typically 50-200 μg/ml) to ensure signal detection while avoiding aggregation

  • Addition of lipids (E. coli polar lipid extract or synthetic lipids) at a lipid:protein ratio of 50:1 to 100:1 can enhance activity

  • Prepare fresh samples before each assay to minimize activity loss due to protein degradation or denaturation

ATPase Activity Assay Methods:

MethodPrincipleAdvantagesLimitations
Malachite greenColorimetric detection of released phosphateSimple, sensitive, endpoint measurementSusceptible to phosphate contamination
Coupled enzyme assayATP hydrolysis coupled to NADH oxidationContinuous monitoring, less prone to artifactsPotential interference from coupling enzymes
Radiolabeled ATPDetection of 32P-labeled phosphate releaseHighly sensitive, direct measurementRequires radioactive materials handling
BioluminescenceATP detection using luciferaseExtremely sensitive, can measure ATP consumptionExpensive reagents, potential light sensitivity

Optimized Protocol for Coupled Enzyme Assay:

  • Reaction buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM MgCl2, 5 mM DTT, 0.1% appropriate detergent

  • Add coupling system: 1 mM phosphoenolpyruvate, 0.25 mM NADH, 2 U/ml pyruvate kinase, 2 U/ml lactate dehydrogenase

  • Establish baseline by monitoring NADH absorbance at 340 nm

  • Initiate reaction by adding ATP (typically 1-5 mM)

  • Monitor decrease in NADH absorbance over time

  • Calculate ATPase activity using the extinction coefficient of NADH (6,220 M-1cm-1)

Activity Modulation Analysis:
To characterize the functional properties of NdvA, its ATPase activity should be measured in response to:

  • Potential transport substrates (beta-(1-->2)glucan oligomers of varying lengths)

  • Varying lipid compositions to identify lipid requirements

  • Inhibitors of ABC transporters (vanadate, BeFx)

  • pH range (pH 5.5-8.5) and temperature variations (25-42°C)

The specific ATPase activity of properly folded NdvA typically ranges from 100-300 nmol Pi/min/mg protein. Deviations from this range may indicate improper folding, detergent-induced artifacts, or species-specific activity differences that should be further investigated .

What approaches can be used to identify potential inhibitors of Bartonella quintana NdvA function?

Identifying potential inhibitors of B. quintana NdvA function requires a multi-faceted approach combining computational methods, in vitro screening, and cellular validation:

Computational Approaches:

  • Homology modeling based on crystal structures of related ABC transporters provides structural templates for virtual screening. Models should incorporate both the nucleotide-binding domains and transmembrane domains of NdvA .

  • Molecular docking of compound libraries against predicted ATP-binding sites or substrate translocation pathways can identify candidate inhibitors. Both commercially available compounds and natural product libraries should be screened .

  • Pharmacophore-based screening using known inhibitors of related ABC transporters can identify compounds with similar chemical features that may inhibit NdvA .

In Vitro Screening Methods:

Screening MethodThroughputInformation GainedTechnical Requirements
ATPase inhibition assayMedium-highDirect measurement of enzymatic inhibitionPurified protein, ATP, detection system
Transport assays in proteoliposomesLow-mediumDirect measurement of substrate transport inhibitionReconstituted protein, labeled substrates
Thermal shift assaysHighLigand-induced stabilizationPurified protein, fluorescent dyes, thermal cycler
Surface plasmon resonanceLow-mediumBinding kinetics and affinityImmobilized protein, specialized equipment

Validation in Cellular Systems:

  • Assess inhibitor effects on beta-(1-->2)glucan export in cultured B. quintana or surrogate expression systems

  • Evaluate impacts on bacterial membrane integrity and composition

  • Measure effects on biofilm formation capacity

  • Determine minimum inhibitory concentrations (MICs) using standardized antimicrobial susceptibility testing

Candidate Inhibitor Classes:
Several classes of compounds have shown promise against related ABC transporters and may serve as starting points for NdvA inhibitor development:

  • ATP analogs modified to enhance selectivity for bacterial ABC transporters over human homologs

  • Polyphenolic compounds that interact with both nucleotide-binding and transmembrane domains

  • Cyclic peptides designed to block substrate binding or translocation pathways

  • Small molecule chelators that interfere with metal cofactor binding required for ATPase activity

When identifying inhibitors, it's crucial to assess specificity by testing against human ABC transporters to minimize potential toxicity. Additionally, evaluating inhibitor activity against NdvA homologs from multiple Bartonella species provides insight into the evolutionary conservation of binding sites and potential for broad-spectrum activity .

What are the critical knowledge gaps in understanding NdvA's role in Bartonella quintana biology?

Despite progress in understanding bacterial ABC transporters, significant knowledge gaps remain regarding the specific functions and mechanisms of NdvA in B. quintana:

Structural Characterization Deficiencies:
No high-resolution structure of B. quintana NdvA or its close homologs has been determined, limiting our understanding of its specific substrate interactions and conformational changes during the transport cycle. Critical questions regarding the substrate-binding pocket architecture and coupling mechanism between ATP hydrolysis and substrate translocation remain unanswered .

Substrate Specificity Uncertainties:
While NdvA is annotated as a beta-(1-->2)glucan export protein based on homology, the exact chemical structure, length, and modifications of the substrates transported by B. quintana NdvA have not been experimentally determined. It remains unknown whether NdvA exhibits broader substrate specificity that might be relevant to pathogenesis .

Regulation Mechanisms:
The transcriptional and post-translational regulation of ndvA expression in response to environmental cues encountered during infection remains poorly characterized. The potential co-regulation with virulence factors and BaGTA components has not been systematically investigated .

Host Interaction Interfaces:
The specific contributions of NdvA-exported substrates to host-pathogen interactions, including potential immunomodulatory effects, adhesion properties, and roles in establishing intracellular niches, require further investigation .

Knowledge Gap Priority Matrix:

Knowledge GapResearch PriorityTechnical FeasibilityPotential Impact
High-resolution structureHighModerateHigh
Substrate identificationHighHighHigh
Regulation mechanismsMediumHighMedium
Host interaction interfacesMediumModerateHigh
Role in BaGTA functionHighLowHigh

Addressing these knowledge gaps requires interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and infection biology. The development of improved genetic tools for Bartonella species would significantly accelerate progress in understanding NdvA's multifaceted roles in bacterial physiology and pathogenesis .

How might NdvA function as a potential target for antimicrobial development against Bartonella infections?

The essential nature of NdvA for B. quintana membrane integrity and potential pathogenesis makes it an attractive target for antimicrobial development, with several considerations warranting exploration:

Target Validation Considerations:

  • Essential nature of NdvA for bacterial viability and/or virulence must be experimentally confirmed

  • Assessment of potential bypass mechanisms or redundant transporters that might confer resistance

  • Evaluation of NdvA conservation across Bartonella species to determine spectrum of coverage

  • Comparison with human ABC transporters to identify exploitable structural differences

Druggability Assessment:
NdvA presents multiple potentially druggable domains:

  • ATP-binding sites in the nucleotide-binding domains

  • Substrate-binding pocket in the transmembrane domains

  • Interface regions critical for conformational changes during transport

  • Potential allosteric sites that regulate transport activity

Therapeutic Strategies:

StrategyMechanismAdvantagesChallenges
Competitive ATP analogsBlock ATP binding/hydrolysisWell-established approach for kinasesSelectivity over human ABC transporters
Substrate mimeticsOccupy substrate-binding siteHigh specificity potentialLimited knowledge of exact substrate structure
Allosteric inhibitorsPrevent conformational changesNovel mechanism, potential synergyDifficult to identify binding sites
Transport-blocking antibodiesRecognize extracellular loopsHigh specificity, different modalityLimited membrane penetration

Potential Synergistic Approaches:
Inhibiting NdvA function could potentiate the activity of existing antibiotics by:

  • Compromising membrane integrity to enhance antibiotic penetration

  • Disrupting biofilm formation to improve access to bacterial cells

  • Interfering with stress response mechanisms that contribute to antibiotic tolerance

  • Preventing the export of molecules involved in quorum sensing or host immune evasion

Development Considerations:
Significant challenges in developing NdvA inhibitors include:

  • The need for compounds that can penetrate the outer membrane of gram-negative bacteria

  • Potential for rapid resistance development through target modification

  • Limited commercial interest in Bartonella-specific therapeutics due to relatively low disease burden

  • Challenges in establishing appropriate animal models for efficacy testing

Despite these challenges, the exploration of NdvA as an antimicrobial target could yield valuable insights into bacterial transport mechanisms and potentially lead to novel therapeutic approaches for difficult-to-treat Bartonella infections, particularly in immunocompromised patients .

What are the most promising future research directions for studying recombinant Bartonella quintana NdvA?

The study of recombinant B. quintana NdvA presents several promising research avenues that could significantly advance our understanding of Bartonella pathogenesis and bacterial transport mechanisms:

Structural Biology Approaches:
High-priority structural investigations include obtaining a high-resolution crystal structure or cryo-EM structure of B. quintana NdvA in different conformational states. These structures would provide crucial insights into the transport mechanism and facilitate structure-based drug design efforts. New approaches in membrane protein crystallization and advances in cryo-EM technology make this increasingly feasible .

Systems Biology Integration:
Integrating NdvA research into broader systems biology approaches examining global regulatory networks in Bartonella would clarify its role in pathogen adaptation. Transcriptomic, proteomic, and metabolomic analyses comparing wild-type and ndvA mutants under various conditions would reveal functional interactions and regulatory mechanisms controlling NdvA expression and activity .

Host-Pathogen Interface Studies:
Detailed investigations of how NdvA-exported substrates interact with host immune receptors and cellular processes would illuminate their role in pathogenesis. Advanced imaging techniques combined with immunological approaches could track the fate of these molecules during infection and their impact on host cell signaling pathways .

Evolutionary Perspectives:
Comparative analyses of NdvA function across the Bartonella genus and related alphaproteobacteria would provide insights into its role in adaptive evolution. This evolutionary perspective could reveal how NdvA function has been modified to support the diverse host specializations observed among Bartonella species .

Translational Research Opportunities:
Beyond basic science, translational applications include:

  • Development of NdvA-based diagnostic markers for Bartonella infections

  • Exploration of NdvA inhibitors as potential therapeutics

  • Investigation of NdvA-exported polysaccharides as vaccine components

  • Engineering of attenuated Bartonella strains with modified NdvA function for research tools

The multifaceted nature of NdvA function presents rich opportunities for interdisciplinary research spanning structural biology, biochemistry, microbial genetics, immunology, and evolutionary biology. Advances in any of these areas would contribute to our understanding of this fascinating protein and its roles in bacterial physiology and host-pathogen interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.